PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g02810.1.p
Common NameBRADI_2g02810, LOC100833882
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB_related
Protein Properties Length: 304aa    MW: 33050 Da    PI: 8.8805
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g02810.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.31e-14149193347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT++E++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  Bradi2g02810.1.p 149 PWTEDEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 193
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.1132780IPR017884SANT domain
SMARTSM007170.152878IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-63283IPR009057Homeodomain-like
PROSITE profilePS5129418.929142198IPR017930Myb domain
SuperFamilySSF466892.54E-17143198IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-17145196IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-11146192IPR009057Homeodomain-like
SMARTSM007171.4E-12146196IPR001005SANT/Myb domain
CDDcd001673.13E-11149194No hitNo description
PfamPF002493.5E-12149193IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MMRESWMDVL PAMDHYAAAA SRGWFMAPPP AWTAQENKQF ERALAALDLR CPDWDRVARD  60
TGKTVLEVMT HFKDLELDVR QIESGMVPFP FYAGGGHGGS AAFTLQWDGA GGHGGAGEFR  120
HGGYRFGGGC GAKRHAGRTP EQERKKGVPW TEDEHKLFLL GLKKYGKGDW RNISRNFVQT  180
RTPTQVASHA QKYFIRLSSG GGKDKRRSSI HDITTVHLTD DRPPSPSQSS LITSNQSNAP  240
STPSVSVGQF SLPGDAKQHG GAPNAAFDSP CSGMPPYGVS LQDQGLQCGP LHDQLAPNRS  300
MLY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3621841e-179AK362184.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2003C15.
GenBankAK3631921e-179AK363192.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013G01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568449.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H73e-75DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLI1HBW40.0I1HBW4_BRADI; Uncharacterized protein
STRINGBRADI2G02810.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.18e-47Homeodomain-like transcriptional regulator